PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10435865g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 405aa    MW: 45533.4 Da    PI: 6.4566
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10435865g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.31.3e-111161148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l++   +   +   +W+ +a+ +g+ R++k+c++rw +yl
  MA_10435865g0010 11 KGLWSAEEDEKLINFMVKKNRPmgcSWTCVAQQIGLQRCGKSCRLRWINYL 61
                      678************9999989***************************97 PP

2Myb_DNA-binding45.12.3e-1471110546
                       -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++eE++ +++++  lG++ W+ Ia++++ gRt++++k++w++
  MA_10435865g0010  71 SAEEEQSIIHLHSVLGNR-WSQIAAHLP-GRTDNEIKNYWNT 110
                       89****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.485661IPR017930Myb domain
SuperFamilySSF466891.37E-248108IPR009057Homeodomain-like
SMARTSM007171.2E-51063IPR001005SANT/Myb domain
PfamPF002493.6E-101161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-171268IPR009057Homeodomain-like
CDDcd001673.98E-61461No hitNo description
PROSITE profilePS5129423.88362116IPR017930Myb domain
SMARTSM007172.5E-1366114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2369116IPR009057Homeodomain-like
PfamPF002499.0E-1371110IPR001005SANT/Myb domain
CDDcd001671.94E-1071110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MTQGQGEGIK KGLWSAEEDE KLINFMVKKN RPMGCSWTCV AQQIGLQRCG KSCRLRWINY  60
LRPGLKHCAI SAEEEQSIIH LHSVLGNRWS QIAAHLPGRT DNEIKNYWNT RIKRKLNLKQ  120
RFLFSSSSET NGNNNTKWNI SSQSDHTYNT NSVSAHARDP YTSFHSAKPM GVMPDVGHLQ  180
SLNNIFNVVT SAENQHSRVQ DVLDLKHEQV QERNNEFIAI DVDPTNNQQI SCSQLWIDST  240
SVHTNESCTL QAQGHTYKTA KSSGYDQLLD PWTTLPPHEA SGSANNGLGH TVTIPALVEI  300
SDSLKGKNEN DGHIINENQN EMMIDNLSFM ASSVKTAWSS SHFYSNTADF SNVYPEAESY  360
PAHNSLSQFS APAILWADVD QYFKIQSQDQ ADCKDLGNLR FDEVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-25111177109B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA5JYE84e-76A5JYE8_PICGL; R2R3-MYB transcription factor MYB4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.38e-46myb domain protein 55